You have no items in your shopping cart.
APOBEC3D Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3D |
| Target | APOBEC3D |
| Protein Sequence | Synthetic peptide located within the following region: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE |
| Molecular Weight | 47 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−APOBEC3D/APOBEC3F Antibody [orb670526]
ELISA, IHC, WB
Human, Monkey
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgAPOBEC3D Rabbit Polyclonal Antibody [orb324527]
WB
Bovine, Porcine, Rabbit
Human
Rabbit
Polyclonal
Unconjugated
100 μlAPOBEC3D/APOBEC3F polyclonal antibody [orb646256]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical is not observed. An isoform containing the peptide sequence is present at 23 kDa.

Rabbit Anti-APOBEC3D Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-APOBEC3D Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
Protocol Information
APOBEC3D Rabbit Polyclonal Antibody (orb577929)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




