You have no items in your shopping cart.
Cart summary
Apelin-36, human
Catalog Number: orb2693403
| Catalog Number | orb2693403 |
|---|---|
| Category | Proteins |
| Description | Apelin-36 (human) is an endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. |
| Target | others |
| Purity | ≥95% |
| Protein Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| MW | 4195.92 |
| CAS Number | 252642-12-9 |
| Formula | C184H297N69O43S |
| Note | For research use only |
Human AP36 ELISA Kit [orb405632]
Human
22.86 pg/mL-400 pg/mL
14.29 pg/mL
24 T, 10 x 96 T, 5 x 96 T, 48 T, 96 T- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
