ANXA1 Rabbit Polyclonal Antibody

• Catalog Number: orb576008
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ANXA1
• Target: ANXA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1
• Protein Sequence: Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
• UniProt ID: P04083
• MW: 39 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ANX1, LPC1
• Research Area: Immunology & Inflammation, Molecular Biology, Stem
• Note: For research use only
• NCBI: NP_000691
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human ACHN, Antibody Dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 0.5 ug/ml.

Human Intestine

WB Suggested Anti-ANXA1 Antibody, Positive Control: Lane 1: 20 ug mouse fibroblast lysates, Primary Antibody Dilution: 1:600, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:2000.

WB Suggested Anti-ANXA1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.