You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215705 |
---|---|
Category | Proteins |
Description | The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602). |
Target | IFN gamma |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144) |
Protein Length | 144 |
MW | 16.9 kDa |
Source | Yeast |
Biological Origin | Rabbit |
Storage | -20°C |
Note | For research use only |
WB | |
Human | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Porcine, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Mouse | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |