OmpC Protein, E. coli, Recombinant (His)

• Catalog Number: orb1979218
• Category: Proteins
• Description: Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.
• Tag: N-6xHis
• Purity: 98.00%
• Protein Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
• UniProt ID: P06996
• MW: 42.3 kDa (predicted)
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expression System: E. coli
• Biological Origin: E. coli
• Biological Activity: Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity.
• Expression Region: 22-367 aa
• Storage: -20°C
• Note: For research use only