You have no items in your shopping cart.
Cart summary
OmpF Protein, E. coli, Recombinant (His & Myc)
Catalog Number: orb1979216
| Catalog Number | orb1979216 |
|---|---|
| Category | Proteins |
| Description | Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) It is also a receptor for the bacteriophage T2. Is the major receptor for colicin E5.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 44.1 kDa (predicted) |
| UniProt ID | P02931 |
| Protein Sequence | AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) It is also a receptor for the bacteriophage T2. Is the major receptor for colicin E5.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity. |
| Expression Region | 23-362 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
