You have no items in your shopping cart.
Cart summary
OmpC Protein, Klebsiella pneumoniae, Recombinant (His & Myc)
Catalog Number: orb1977544
| Catalog Number | orb1977544 |
|---|---|
| Category | Proteins |
| Description | Forms pores that allow passive diffusion of small molecules across the outer membrane. In K.pneumoniae it has been shown to bind the C1Q component and activate the classical pathway of the complement system. OmpC Protein, Klebsiella pneumoniae, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 45.0 kDa and the accession number is Q48473. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | AEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKGKDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLVYQF |
| UniProt ID | Q48473 |
| MW | 45.0 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Klebsiella pneumoniae |
| Biological Activity | Forms pores that allow passive diffusion of small molecules across the outer membrane. In K.pneumoniae it has been shown to bind the C1Q component and activate the classical pathway of the complement system. OmpC Protein, Klebsiella pneumoniae, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 45.0 kDa and the accession number is Q48473. |
| Expression Region | 22-363 aa |
| Storage | -20°C |
| Note | For research use only |
