Lck Antibody

• Catalog Number: orb334540
• Category: Antibodies
• Description: Lck Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Mouse Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 58001 MW
• UniProt ID: P06239
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tyrosine-protein kinase Lck;2.7.10.2;Leukocyte C-t
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HepG2 cells using anti-Lck antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Lck using anti-Lck antibody.Lane 1:human Jurkat cell; 2:mouse spleen tissue; 3:mouse thymus tissue.

IF analysis of Lck using anti-Lck antibody. Lck was detected in immunocytochemical section of U20S cells.

IHC analysis of Lck using anti-Lck antibody. Lck was detected in a paraffin-embedded section of mouse lymphaden tissue.

IHC analysis of Lck using anti-Lck antibody. Lck was detected in a paraffin-embedded section of rat lymphaden tissue.

IHC analysis of Lck using anti-Lck antibody. Lck was detected in a paraffin-embedded section of human tonsil tissue.

IHC analysis of Lck using anti-Lck antibody. Lck was detected in frozen section of mouse spleen tissue.