Human TIMP-2 protein

Catalog Number: orb245328

Catalog Number	orb245328
Category	Proteins
Description	Recombinant human Metalloproteinase inhibitor 2
Reactivity	Human
Tag	N-terminal GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	48.5 kDa
UniProt ID	P16035
Protein Sequence	SPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Protein Length	Partial
Source	E.coli
Expression Region	30-220aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	TIMP-2, TIMP2, CSC-21K Read more...
Note	For research use only
Application notes	This is GST-tag protein
Expiration Date	6 months from date of receipt.

Purity:	> 95% by Tris-Bis PAGE, > 95% by SEC-HPLC
Source:	KMP2120, Recombinant Human TIMP-2 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Cys27-Pro220) of Human TIMP-2 fused with a His Tag at the C-terminal.

Sizes Available: 100 μg, 500 μg

Conjugation:	Unconjugated
Purity:	95%
MW:	22.6 kDa
Source:	Human TIMP-2, His Tag (orb257870) is expressed from human 293 cells (HEK293). It contains AA Cys 27 - Pro 220 (Accession # NP_003246.1).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human TIMP2(Cys27-Pro220) was fused with the C-terminal His Tag and expressed in Mammalian cells.