You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human PLA2R1 protein
Catalog Number: orb358905
| Catalog Number | orb358905 |
|---|---|
| Category | Proteins |
| Description | Recombinant human PLA2R1 protein |
| Tag | N-terminal 6xHis-Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
| Protein Length | Partial |
| UniProt ID | Q13018 |
| MW | 19.4 kDa |
| Application notes | Partial of HIS-tag and expression region is 19.06kDa |
| Endotoxins | Not test. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 395-530aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | 180KDA secretory phospholipase A2 receptor C-type Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human PLA2R1 protein [orb244826]
Greater than 90% as determined by SDS-PAGE.
19.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Human PLA2R1 protein [orb246853]
Greater than 90% as determined by SDS-PAGE.
17.4 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 2
Human PLA2R1 full length protein-synthetic nanodisc [orb1826412]
The human full length PLA2R1 protein has a MW of 168.6 kDa
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human PLA2R1 protein [orb704673]
Greater than 85% as determined by SDS-PAGE.
19.3 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 1
Human PLA2R1(21-521+1097-1246) Protein, His Tag [orb1826808]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 76.0 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1(21-521 1097-1246)-10×His is approximately 70-130 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
