You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594741 |
---|---|
Category | Proteins |
Description | Recombinant Human Fibroblast growth factor receptor 3(FGFR3),partial (Active) |
Tag | C-terminal Fc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 64.8 kDa |
UniProt ID | P22607 |
Protein Sequence | ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | Expression Region: 23-375aa. Protein Length: Partial |
Biological Activity | The ED50 as determined by its ability to inhibit FGF acidic-dependent proliferation of BALB/c 3T3 cells is less than 100 ng/ml. |
Expression Region | 23-375aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Fibroblast growth factor receptor 3; FGFR-3; CD333 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Functional Studies, IA, WB | |
> 95% | |
39.7 | |
HEK293 cells |
Functional Studies, IA, WB | |
> 95% | |
41.2 | |
HEK293 cells |
Greater than 90% as determined by SDS-PAGE. | |
40.1 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
47.4 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
59.4 kDa | |
E.coli |
Filter by Rating