You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FGFR3 protein
Catalog Number: orb594741
| Catalog Number | orb594741 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Fibroblast growth factor receptor 3(FGFR3),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG |
| Protein Length | Partial |
| UniProt ID | P22607 |
| MW | 64.8 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human FGF-12 at 2ug/ml can bind Human FGFR3-Fc, the ED50 of Recombinant Human FGFR3-Fc is 0.5-4 ug/ml. |
| Expression Region | 23-375aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Fibroblast growth factor receptor 3; FGFR-3; CD333 Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human FGFR3 protein [orb245837]
Greater than 90% as determined by SDS-PAGE.
40.1 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human FGFR3 protein [orb244208]
Greater than 90% as determined by SDS-PAGE.
42.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human FGFR3 protein [orb54116]
Greater than 90% as determined by SDS-PAGE.
47.4 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human FGFR3 protein [orb54587]
Greater than 90% as determined by SDS-PAGE.
59.4 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Human FGFR3 Protein, His Tag [orb1291775]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.0 kDa after removal of the signal peptide. The apparent molecular mass of FGFR3-His is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg
