CD45/PTPRC Antibody

• Catalog Number: orb334517
• Category: Antibodies
• Description: CD45/PTPRC Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IF, IHC, IHC-Fr, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD45 (1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 147254 MW
• UniProt ID: P08575
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Receptor-type tyrosine-protein phosphatase C;3.1.3
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of CD45 using anti-CD45 antibody.Lane 1:JURKAT Cell;2:HL-60 Cell;3:K562 Cell.

IF analysis of CD68 and CD45 using anti-CD68 antibody and anti-CD45 antibody.CD68 and CD45 was detected in paraffin-embedded section of human tonsil tissues.

IHC analysis of CD45 using anti-CD45 antibody.CD45 was detected in paraffin-embedded section of Human Tonsil Tissue.