You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334517 |
---|---|
Category | Antibodies |
Description | CD45/PTPRC Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IF, IHC, IHC-Fr, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CD45 (1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 147254 MW |
UniProt ID | P08575 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Receptor-type tyrosine-protein phosphatase C;3.1.3 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of CD45 using anti-CD45 antibody.Lane 1:JURKAT Cell;2:HL-60 Cell;3:K562 Cell.
IF analysis of CD68 and CD45 using anti-CD68 antibody and anti-CD45 antibody.CD68 and CD45 was detected in paraffin-embedded section of human tonsil tissues.
IHC analysis of CD45 using anti-CD45 antibody.CD45 was detected in paraffin-embedded section of Human Tonsil Tissue.
ELISA, ICC, IF, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating