Apolipoprotein E antibody

• Catalog Number: orb333722
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Apolipoprotein E
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOE
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36 kDa
• Target: APOE
• UniProt ID: P02649
• Protein Sequence: Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF
• NCBI: NP_000032
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of mouse brain tissue using Apolipoprotein E antibody

Immunohistochemical staining of human kidney tissue using Apolipoprotein E antibody

Immunohistochemical staining of human Adrenal tissue using Apolipoprotein E antibody

Immunohistochemical staining of human Liver tissue using Apolipoprotein E antibody

Western blot analysis of human Brain tissue using Apolipoprotein E antibody

Western blot analysis of human Fetal liver tissue using Apolipoprotein E antibody