YY1 Antibody

• Catalog Number: orb610910
• Category: Antibodies
• Description: YY1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 44713 MW
• UniProt ID: P25490
• Sensitivity: > 5000 cells
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Alternative names: Transcriptional repressor protein YY1;Delta transc
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis using anti-YY1 antibody.Lane 1:mouse thymus tissue, Lane 2:mouse spleen tissue, Lane 3:rat thymus tissue, Lane 4:rat PC-12 cell, Lane 5:mouse RAW264.7 cell, Lane 6:PC-3 cell, Lane 7:SW620 cell.

Flow Cytometry analysis of THP-1 cells using anti-YY1 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

IF analysis of YY1 using anti-YY1 antibody.