YY1 Antibody (monoclonal, 2C10F9)

• Catalog Number: orb1145861
• Category: Antibodies
• Description: YY1 Antibody (monoclonal, 2C10F9)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C10F9
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG2a
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5 μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 65 kDa
• UniProt ID: P25490
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human thyroid cancer tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human pancreatic ductal adenocarcinoma tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinomas tissue.

IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human renal clear cell carcinoma tissue.

Western blot analysis of YY1 using anti-YY1 antibody.

Flow Cytometry analysis of PC-3 cells using anti-YY1 antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.