You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1145860 |
---|---|
Category | Antibodies |
Description | YY1 Antibody (monoclonal, 3F3E7) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3F3E7 |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG1 |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human YY1 (206-241aa EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5 μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 65 kDa |
UniProt ID | P25490 |
Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human thyroid cancer tissue.
IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinomas tissue.
IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human ovarian serous cancer tissue.
IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human pancreatic ductal adenocarcinoma tissue.
IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human serous adenocarcinoma of ovary tissue.
IHC analysis of YY1 using anti-YY1 antibody. YY1 was detected in a paraffin-embedded section of human the muscular layer of a colonic adenocarcinoma tissue.
IF analysis of YY1 using anti-YY1 antibody.YY1 was detected in an immunocytochemical section of T-47D cells.
Western blot analysis of YY1 using anti-YY1 antibody.
Flow Cytometry analysis of A431 cells using anti-YY1 antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating