Villin/VIL1 Antibody

• Catalog Number: orb259634
• Category: Antibodies
• Description: Villin/VIL1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunofluorescence, 2μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 92695 MW
• UniProt ID: P09327
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Villin-1;VIL1;VIL;
• Note: For research use only
• Application notes: WB: The detection limit for Villin is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of CACO-2 cells using anti-Villin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of Villin using anti-Villin antibody.Lane 1:Rat Intestine Tissue2:Mouse Kidney Tissue3:RH35 Cell4:HEPG2 Cell;5:MCF-7 Cell.

IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of rat intestine tissues.

IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of mouse intestine tissues.

IF analysis of Villi using anti-Villi antibody.Villi was detected in paraffin-embedded section of human rectal cancer tissues.

IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of human ileum tissue.

IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of human colon organoid tissue.

IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of mouse ileum tissue.

IF analysis of Villin using anti-Villin antibody.Villin was detected in paraffin-embedded section of mouse ileum organoid tissue.

IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of Villin using anti-Villin antibody. Villin was detected in a paraffin-embedded section of rat intestine tissue.