TRPV5 Antibody

• Catalog Number: orb308813
• Category: Antibodies
• Description: TRPV5 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TRPV5 (580-610aa DTHWRVAQERDELWRAQVVATTVMLERKLPR), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 82551 MW
• UniProt ID: Q9NQA5
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Transient receptor potential cation channel subfam
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of TRPV5 using anti-TRPV5 antibody.Lane 1:Rat Pancreas Tissue;2:Rat Lung Tissue;3:Rat Intestine Tissue;4:SW620 Cell;5:COLO320 Cell;6:293T Cell.