TNF beta Protein, Human, Recombinant (His)

Catalog Number: orb1978295

Catalog Number	orb1978295
Category	Proteins
Description	Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.
Tag	N-6xHis
Purity	98.00%
MW	20.8 kDa (predicted)
UniProt ID	P01374
Protein Sequence	LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Expression System	HEK293 Cells
Biological Origin	Human
Biological Activity	Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.
Expression Region	35-205 aa
Storage	-20°C
Note	For research use only
Application notes	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Expiration Date	6 months from date of receipt.

Purity:	98.00%
MW:	61.6 kDa (predicted). Due to glycosylation, the protein migrates to 80-100 kDa based on Tris-Bis PAGE result.

Purity:	Greater than 90% as determined by SDS-PAGE.
Source:	Escherichia Coli

Purity:	SDS-PAGE: > 95%
MW:	15.7 kDa (predicted); 20 kDa (reducing condition, due to glycosylation)