Tjp1 antibody

Catalog Number: orb329876

Catalog Number	orb329876
Category	Antibodies
Description	Rabbit polyclonal antibody to Tjp1
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	WB
Predicted Reactivity	Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Reactivity	Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
Concentration	0.5 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	190kDa
Target	Tjp1
UniProt ID	A0A0G2K2P5
Protein Sequence	Synthetic peptide located within the following region: AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE
NCBI	NP_001099736
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	anti ZO-1 antibody Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Western blot analysis of rat Lung tissue using Tjp1 antibody

Item 1 of 10

Applications:	IF, IHC-Fr, IHC-P, WB
Reactivity:	Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Species/Host:	Goat
Clonality:	Polyclonal
Conjugation:	Unconjugated

Sizes Available: 100 μg