Tec Antibody

• Catalog Number: orb402225
• Category: Antibodies
• Description: Tec Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 73 kDa
• UniProt ID: P42680
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tyrosine-protein kinase Tec; TEC; PSCTK4
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Tec using anti-Tec antibody.Lane 1:human HeLa Cell;2:human MCF-7 Cell;3:human COLO-320 Cell;4:human HepG2 Cell;5:rat stomach Tissue;6:mouse stomach Tissue;7:mouse heart Tissue.