You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402225 |
---|---|
Category | Antibodies |
Description | Tec Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 73 kDa |
UniProt ID | P42680 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Tyrosine-protein kinase Tec; TEC; PSCTK4 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Tec using anti-Tec antibody.Lane 1:human HeLa Cell;2:human MCF-7 Cell;3:human COLO-320 Cell;4:human HepG2 Cell;5:rat stomach Tissue;6:mouse stomach Tissue;7:mouse heart Tissue.
ELISA, FC, IF, IHC | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating