SPATA46 Rabbit Polyclonal Antibody

SKU: orb580250

Description

SPATA46 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SPATA46. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human C1orf111. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf111
• Target: SPATA46
• Protein Sequence: Synthetic peptide located within the following region: CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLRQIGGEAYLCL
• Molecular Weight: 29kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HSD20, C1orf111

Quick Database Links

Gene Symbol

SPATA46

UniProt

Q5T0L3

RefSeq (Protein):NP_872387