Cart summary

You have no items in your shopping cart.

SPATA46 Rabbit Polyclonal Antibody (Biotin)

SPATA46 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2114974

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2114974
CategoryAntibodies
DescriptionSPATA46 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C1orf111
Protein SequenceSynthetic peptide located within the following region: CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLRQIGGEAYLCL
UniProt IDQ5T0L3
MW29kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHSD20, C1orf111
NoteFor research use only
NCBINP_872387