SOX5 Antibody

• Catalog Number: orb308802
• Category: Antibodies
• Description: SOX5 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Porcine, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Pig
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 84026 MW
• UniProt ID: P35711
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Transcription factor SOX-5;SOX5;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SOX5 using anti-SOX5 antibody.Lane 1:Rat Liver Tissue;2:Rat Testis Tissue;3:Rat Brain Tissue;4:HELA Cell;5:A549 Cell.

WB analysis of SOX5 using anti-SOX5 antibody.All lanes: pig adipose cells.

WB analysis of SOX5 using anti-SOX5 antibody.Lane 1:mouse spleen Tissue;2:mouse thymus Tissue.