You have no items in your shopping cart.
Cart summary
SH2D2A Peptide - middle region
Catalog Number: orb2001254
| Catalog Number | orb2001254 |
|---|---|
| Category | Proteins |
| Description | SH2D2A Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: HYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSP |
| UniProt ID | Q9NP31 |
| MW | 43 kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | SCAP, TSAD, VRAP, F2771 |
| Note | For research use only |
| NCBI | NP_001154914.1 |
