You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2001254 |
---|---|
Category | Proteins |
Description | SH2D2A Peptide - middle region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: HYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSP |
UniProt ID | Q9NP31 |
MW | 43 kDa |
Tested applications | WB |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | SCAP, TSAD, VRAP, F2771 |
Note | For research use only |
NCBI | NP_001154914.1 |