Cart summary

You have no items in your shopping cart.

SH2D2A Peptide - middle region

SH2D2A Peptide - middle region

Catalog Number: orb2001126

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001126
CategoryProteins
DescriptionSH2D2A Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: AGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLL
UniProt IDQ9NP31
MW42 kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with SH2D2A Rabbit Polyclonal Antibody (orb55763). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesSCAP, TSAD, VRAP, F2771
NoteFor research use only
NCBINP_001154914.1