You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
RGS5 Rabbit Polyclonal Antibody
Catalog Number: orb592742
| Catalog Number | orb592742 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RGS5 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RGS5 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 21kDa |
| Target | RGS5 |
| UniProt ID | O15539 |
| Protein Sequence | Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS |
| NCBI | NP_003608 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Hum. Fetal Heart
WB Suggested Anti-RGS5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
- Item 1 of 3
Anti-RGS5 Antibody [orb214790]
IF, IH, WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 3
- Item 1 of 2
RGS5 Antibody [orb128633]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μg, 100 μg, 50 μg, 25 μg - Item 1 of 2
- Item 1 of 2
