RGS5 Rabbit Polyclonal Antibody (Biotin)

SKU: orb2081194

Description

RGS5 Rabbit Polyclonal Antibody (Biotin)

Images & Validation

• Tested Applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGS5
• Protein Sequence: Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS
• Molecular Weight: 21kDa
• Conjugation: Biotin

Storage & Handling

• Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129

Quick Database Links

UniProt

O15539

RefSeq (Protein):NP_003608