You have no items in your shopping cart.
Cart summary
Rabbit Anti Green Fluorescent Protein (GFP) Antibody
Catalog Number: orb1678899
| Catalog Number | orb1678899 |
|---|---|
| Category | Antibodies |
| Description | The product is affinity purified and specifically recognizes the Green Fluorescent Protein (GFP). The antibody can be used for variety of application. The antibody is rabbit polyclonal antibody raised against Green Fluorescent Protein (GFP). It has been selected for its ability to recognize GFP in immunohistochemical staining and western blotting.It is recommended that the end user optimizes the product for their particular application with appropriate controls. |
| Clonality | Polyclonal |
| Immunogen | Recombinant GFP (KETWWETWWTEWSQPKKKRKGMet1~Lys238myc-FLAG tag) expressed in E.coli |
| Form/Appearance | Liquid |
| Conjugation | Unconjugated |
| Buffer/Preservatives | 0.01M PBS, pH 7.4, containing 0.05% Proclin-300, 50% glycerol. |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars