Rab11A Antibody

• Catalog Number: orb334521
• Category: Antibodies
• Description: Rab11A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 24394 MW
• UniProt ID: P62491
• Sensitivity: > 5000 cells
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Ras-related protein Rab-11A;Rab-11;YL8;RAB11A;RAB1
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-Rab11A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB:1:HeLacell;2:human placenta tissue;3:COLO-320cell;4:HepG2 cell;5:22RV1 cell;6:SGC-7901 cell;7:MDA-MB-453 cell;8:Jurkat cell;9:rat kidney tissue;10:rat testis tissue;11:rat brain tissue;12:mouse testis tissue;13:mouse brain tissue;14:NIH/3T3 cell.

IF analysis of Rab11A using anti-Rab11A antibody.Rab11A was detected in immunocytochemical section of human U20S cell.