Cart summary

You have no items in your shopping cart.

Rab11A Antibody

Catalog Number: orb334521

DispatchUsually dispatched within 5-10 working days
$ 520.00
Catalog Numberorb334521
CategoryAntibodies
DescriptionRab11A Antibody
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Gallus, Monkey, Rabbit
ReactivityHuman, Mouse, Rat
IsotypeRabbit IgG
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Dilution rangeWestern blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Form/AppearanceLyophilized
ConjugationUnconjugated
MW24394 MW
UniProt IDP62491
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Alternative namesRas-related protein Rab-11A;Rab-11;YL8;RAB11A;RAB1
Read more...
NoteFor research use only
Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Expiration Date12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-Rab11A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB:1:HeLacell;2:human placenta tissue;3:COLO-320cell;4:HepG2 cell;5:22RV1 cell;6:SGC-7901 cell;7:MDA-MB-453 cell;8:Jurkat cell;9:rat kidney tissue;10:rat testis tissue;11:rat brain tissue;12:mouse testis tissue;13:mouse brain tissue;14:NIH/3T3 cell.

IF analysis of Rab11A using anti-Rab11A antibody.Rab11A was detected in immunocytochemical section of human U20S cell.

  • Rab11A Antibody (monoclonal, 4H9) [orb763197]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

    10 μg, 100 μg
  • RAB11A Antibody [orb1258790]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl
  • RAB11A antibody [orb541231]

    ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • Rab11 antibody [orb100719]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Mouse, Porcine, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • RAB11A antibody [orb340737]

    IF,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
Submit a review

Filter by Rating

    • Star
    • Star
    • Star
    • Star
    • Star
    • 5 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 4 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 3 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 2 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 1 stars