You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334521 |
---|---|
Category | Antibodies |
Description | Rab11A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Gallus, Monkey, Rabbit |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 24394 MW |
UniProt ID | P62491 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Ras-related protein Rab-11A;Rab-11;YL8;RAB11A;RAB1 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A549 cells using anti-Rab11A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB:1:HeLacell;2:human placenta tissue;3:COLO-320cell;4:HepG2 cell;5:22RV1 cell;6:SGC-7901 cell;7:MDA-MB-453 cell;8:Jurkat cell;9:rat kidney tissue;10:rat testis tissue;11:rat brain tissue;12:mouse testis tissue;13:mouse brain tissue;14:NIH/3T3 cell.
IF analysis of Rab11A using anti-Rab11A antibody.Rab11A was detected in immunocytochemical section of human U20S cell.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating