You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 1.0 pg/ml, corresponding to a specific activity of > 1.0 x 10 ^ 9 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 117-269aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 17.3 kDa |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1 beta,
Similar Products
−Recombinant human IL-1b protein (Active, HEK293) [orb1817211]
>95% as determined by SDS-PAGE
18-25 kDa
10 μg, 50 μg, 500 μgRecombinant human IL-1B protein (Active, E.coli) [orb3124197]
≥ 95% as determined by SDS-PAGE.
17.4 kDa
10 μg, 50 μg, 500 μgHuman Interleukin-1 beta (IL1B) (Active) Recombinant Protein [orb1650656]
>97% as determined by SDS-PAGE and HPLC.
17.3 kDa
1 mg, 500 μg, 250 μg, 100 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


