You have no items in your shopping cart.
Featured
Description
Research Area
Signal Transduction
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-Myc-tagged |
| Expression Region | 678-751aa |
| Protein Length | Partial |
| MW | 12.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anaphylatoxin C5a analog protein, Anaphylatoxin C5a protein, C5a anaphylatoxin protein, C5a des Arg protein, Complement C5 alpha chain protein, Complement C5 protein, Complement component C5 protein, Complement component C5a protein, CPAMD4 protein
Similar Products
−Recombinant Human Complement C5 (Active) [orb3155656]
Greater than 90% as determined by SDS-PAGE.
188.0 kDa
Mammalian cell
1 mg, 100 μg, 20 μgC5a Rabbit Polyclonal Antibody [orb323296]
ELISA, IHC-P
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgRecombinant Human C5AR1 N-ECD Protein [orb2992554]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified). SEC-HPLC: Greater than 95% as determined by SEC-HPLC.(QC verified)
Predicted: 31.2 KDa. Observed: 38-50 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide











