AVS Bio - Recombinant human C5a

SKU: C008

Description

The C5 protein is the fifth component of complement and plays an important role in inflammatory and cell killing processes. C5 is comprised of alpha and beta polypeptide chains that are linked by a disulfide bridge. An activation peptide, C5a, which is an anaphylatoxin that possesses potent spasmogenic and chemotactic activity, is derived from the alpha polypeptide via cleavage with a convertase. The C5b macromolecular cleavage product can form a complex with the C6 complement component, and this complex is the basis for formation of the membrane attack complex, which includes additional complement components. Mutations in this gene cause complement component 5 deficiency, a disease where patients show a propensity for severe recurrent infections. Defects in this gene have also been linked to a susceptibility to liver fibrosis and to rheumatoid arthritis. Residues 678-751 of human C5 were cloned, the protein was over-expressed in HEK293EBNA1 cells and was purified to homogeneity. The calculated molecular weight of recombinant human C5a is 9.5 kDa and it contains an N-terminal hexahistidine tag. Each vial contains 100 µg C5a.

Key Properties

• Protein Sequence: marplctllllmatlagalagshhhhhhgstlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlranishkdmqlgr*

Storage & Handling

• Storage: Recombinant C5a should be stored at - 80°C (stable for at least 1 year). The enzyme is stored in PBS. Afterthawing it should be stored in appropriate small aliquots at - 20°C or - 80°C (stable for at least 2 months).
• Form/Appearance: solution
• Expiration Date: For shelf life and expiration details, please refer to the Certificate of Analysis (CoA).
• Dry Ice Shipping: Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
• Disclaimer: For research use only

Alternative Names

anaphylatoxin; anaphylatoxin C5a analog; complement C5 isoform 1 preproprotein; Complement component 5; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; prepro-C5;; C5a anaphylatoxin"

Quick Database Links

UniProt

P01031