You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331010 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PGP9.5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25kDa |
Target | UCHL1 |
UniProt ID | P09936 |
Protein Sequence | Synthetic peptide located within the following region: HLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALC |
NCBI | NP_004172 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti-Epididymis luminal protein 117 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human pancreas tissue using UCHL1 antibody
Immunohistochemical staining of rat pancreas tissue using UCHL1 antibody
Immunohistochemical staining of rat pancreas tissue using UCHL1 antibody
Western blot analysis of human 721_B tissue using UCHL1 antibody
Western blot analysis of human brain tissue using UCHL1 antibody
ELISA, ICC, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Equine, Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating