PGP9.5/UCHL1 Antibody

• Catalog Number: orb334572
• Category: Antibodies
• Description: PGP9.5/UCHL1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 24824 MW
• UniProt ID: P09936
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Ubiquitin carboxyl-terminal hydrolase isozyme L1;U
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of K562 cells using anti-PGP9.5 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of PGP9.5 using anti-PGP9.5 antibody.Lane 1:human U87 cell; 2:human SH-SY5Y cell; 3:rat brain tissue; 4:rat C6 cell; 3:mouse brain tissue.

IF analysis of PGP9.5 using anti-PGP9.5 antibody.PGP9.5 was detected in immunocytochemical section of SH-SY5Y cells.

IHC analysis of PGP9.5 using anti-PGP9.5 antibody.PGP9.5 was detected in a paraffin-embedded section of human glioma tissue.

IHC analysis of PGP9.5 using anti-PGP9.5 antibody.PGP9.5 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of PGP9.5 using anti-PGP9.5 antibody.PGP9.5 was detected in a paraffin-embedded section of rat brain tissue.