PGD Rabbit Polyclonal Antibody

SKU: orb585508

Description

Rabbit polyclonal antibody to PGD

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of PGD
• Target: PGD
• Protein Sequence: Synthetic peptide located within the following region: DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE
• Molecular Weight: 53kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

6PGD

PGD was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb585508 with 1:200 dilution. Western blot was performed using orb585508 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: PGD IP with orb585508 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-PGD Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell. PGD is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

PGD

UniProt

P52209

RefSeq (Protein):NP_002622