PGD Rabbit Polyclonal Antibody (Biotin)

SKU: orb2094181

Description

Images & Validation

−

Tested Applications	WB
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Related Conjugates & Formulations

−

Unconjugated

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of PGD
Protein Sequence	Synthetic peptide located within the following region: DFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGE
Molecular Weight	53kDa
Purification	Affinity Purified
Conjugation	Biotin

Storage & Handling

−

Storage	All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer.
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

6PGD

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P52209

RefSeq (Protein):NP_002622

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_002622

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols