Peptide YY/PYY Antibody

• Catalog Number: orb527005
• Category: Antibodies
• Description: Peptide YY/PYY Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Peptide YY/PYY (YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• UniProt ID: P10082
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Peptide YY; PYY; PYY-I; Peptide tyrosine tyrosine;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of Peptide YY/PYY using anti-Peptide YY/PYY antibody.Peptide YY/PYY was detected in paraffin-embedded section of human appendicitis tissue tissues.