You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb371748 |
---|---|
Category | Antibodies |
Description | Peptide YY/PYY Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC, WB |
Reactivity | Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Mouse Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Immunofluorescence, 5 μg/ml, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 11064 MW |
UniProt ID | Q9EPS2 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Peptide YY ;PYY ;Peptide tyrosine tyrosine;Peptide Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Peptide YY using anti-Peptide YY antibody.Lane 1:mouse spleen tissue;2:mouse liver tissue.
IF analysis of Peptide YY using anti-Peptide YY antibody. Peptide YY was detected in a paraffin-embedded section of rat stomach tissue.
IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse intestine tissues.
IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse intestine tissues.
IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse pancreas tissues.
IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of rat intestine tissues.
IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of rat pancreas tissues.
Filter by Rating