Peptide YY/PYY Antibody

• Catalog Number: orb371748
• Category: Antibodies
• Description: Peptide YY/PYY Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Immunofluorescence, 5 μg/ml, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 11064 MW
• UniProt ID: Q9EPS2
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Peptide YY ;PYY ;Peptide tyrosine tyrosine;Peptide
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Peptide YY using anti-Peptide YY antibody.Lane 1:mouse spleen tissue;2:mouse liver tissue.

IF analysis of Peptide YY using anti-Peptide YY antibody. Peptide YY was detected in a paraffin-embedded section of rat stomach tissue.

IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse intestine tissues.

IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse intestine tissues.

IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse pancreas tissues.

IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of rat intestine tissues.

IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of rat pancreas tissues.