You have no items in your shopping cart.
Cart summary
OmpC Protein, E. coli, Recombinant
Catalog Number: orb1979217
| Catalog Number | orb1979217 |
|---|---|
| Category | Proteins |
| Description | Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity. |
| Tag | Tag Free |
| Purity | 98.00% |
| Protein Sequence | AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF |
| UniProt ID | P06996 |
| MW | 38.3 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Forms pores that allow passive diffusion of small molecules across the outer membrane.; (Microbial infection) Supports colicin E5 entry in the absence of its major receptor OmpF.; (Microbial infection) A mixed OmpC-OmpF heterotrimer is the outer membrane receptor for toxin CdiA-EC536; polymorphisms in extracellular loops 4 and 5 of OmpC confer susceptibility to CdiA-EC536-mediated toxicity. |
| Expression Region | 22-367 aa |
| Storage | -20°C |
| Note | For research use only |
- Item 1 of 3
E. coli ompC protein [orb358167]
Greater than 90% as determined by SDS-PAGE.
54.3 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 3
E. coli ompC protein [orb604724]
Greater than 85% as determined by SDS-PAGE.
38.3 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 3
E. coli ompC protein [orb604723]
Greater than 85% as determined by SDS-PAGE.
42.3 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
E. coli ompC protein [orb383379]
Greater than 90% as determined by SDS-PAGE.
58.4 kDa
E.coli
20 μg, 100 μg, 1 mg OmpC Protein, Klebsiella pneumoniae, Recombinant (His & Myc) [orb1977544]
98.00%
45.0 kDa (predicted)
1 mg, 100 μg, 20 μg
