OmpA Protein, E. coli, Recombinant (His)

• Catalog Number: orb1979215
• Category: Proteins
• Description: OmpA Protein, E. coli, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is P0A910.
• Tag: N-10xHis
• Purity: 98.00%
• Protein Sequence: APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
• UniProt ID: P0A910
• MW: 38.0 kDa (predicted)
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expression System: E. coli
• Biological Origin: E. coli
• Biological Activity: OmpA Protein, E. coli, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is P0A910.
• Expression Region: 22-346 aa
• Storage: -20°C
• Note: For research use only