You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979698 |
---|---|
Category | Proteins |
Description | OmpA Protein, Borrelia burgdorferi, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.9 kDa and the accession number is P0A3N6. |
Tag | N-10xHis, C-Myc |
Purity | 98.00% |
Protein Sequence | CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK |
UniProt ID | P0A3N6 |
MW | 32.9 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Borrelia burgdorferi |
Biological Activity | OmpA Protein, Borrelia burgdorferi, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.9 kDa and the accession number is P0A3N6. |
Expression Region | 17-273 aa |
Storage | -20°C |
Note | For research use only |