NAB1 antibody

• Catalog Number: orb329639
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NAB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: NAB1
• UniProt ID: Q13506
• Protein Sequence: Synthetic peptide located within the following region: ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNA
• NCBI: NP_005957
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Intestine tissue using NAB1 antibody

Western blot analysis of Transfected 293T tissue using NAB1 antibody

Immunohistochemical staining of human Prostate tissue using NAB1 antibody