You have no items in your shopping cart.
Cart summary
MYL12B Protein, Human, Recombinant (His)
Catalog Number: orb2816186
| Catalog Number | orb2816186 |
|---|---|
| Category | Proteins |
| Description | MYL12B Protein, Human, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is O14950. |
| Tag | C-6xHis |
| Protein Sequence | MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
| UniProt ID | O14950 |
| MW | 26.7 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 1-172 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Recombinant Human MYL12B Protein, N-His [orb2837064]
>90% as determined by SDS-PAGE.
21.66 kDa
100 μg, 20 μg, 50 μgMYL12B Protein, Human, Recombinant (Yeast, His) [orb2946421]
21.8 kDa (Predicted)
100 μg, 20 μg, 1 mgRecombinant Human MYL12B Protein, N-His [orb2969981]
>90% as determined by SDS-PAGE.
21.66 kDa
1 mg, 100 μg, 50 μg
