You have no items in your shopping cart.
Cart summary
MYL12B Protein, Human, Recombinant (Yeast, His)
Catalog Number: orb2946421
| Catalog Number | orb2946421 |
|---|---|
| Category | Proteins |
| Description | MYL12B Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. The accession number is O14950. |
| Tag | C-10xHis |
| Protein Sequence | MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
| UniProt ID | O14950 |
| MW | 21.8 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Expression Region | 1-172 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
