MMP9 Antibody

• Catalog Number: orb371742
• Category: Antibodies
• Description: MMP9 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat MMP-9 (622-658aa RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS), different from the related human sequence by nineteen amino acids, and from the related mouse sequence by nine amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 78611 MW
• UniProt ID: P50282
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Matrix metalloproteinase-9;MMP-9;3.4.24.35;92 kDa
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of MMP-9 using anti-MMP-9 antibody.Lane 1:NRK cell.

IHC analysis of MMP-9 using anti-MMP-9 antibody. MMP-9 was detected in a paraffin-embedded section of mouse spleen tissue.

IHC analysis of MMP-9 using anti-MMP-9 antibody. MMP-9 was detected in a paraffin-embedded section of rat spleen tissue.