MMP9 Antibody

• Catalog Number: orb315177
• Category: Antibodies
• Description: MMP9 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP-9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat ELISA , 0.1-0.5μg/ml, Mouse, -Western blot, 0.1-0.5μg/ml, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 80535 MW
• UniProt ID: P41245
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Matrix metalloproteinase-9;MMP-9;3.4.24.35;92 kDa
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of NRK Whole Cell Lysate(lane 1), ANA-1 Whole Cell Lysate(lane 2), HEPA Whole Cell Lysate(lane 3) using MMP9 antibody

Immunohistochemical staining of Rat Liver Tissue using MMP9 antibody

Immunohistochemical staining of Mouse Kidney Tissue using MMP9 antibody