RACK1 Rabbit Polyclonal Antibody

• Catalog Number: orb584982
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RACK1
• Target: RACK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: RLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGV
• UniProt ID: P68040
• MW: 35kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: p20, Gnb2, p205, GB-li, Gnb2-, Gnb2l1, GB-like, AL
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_032169

WB Suggested Anti-Gnb2l1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.