RACK1 Rabbit Polyclonal Antibody

• Catalog Number: orb577699
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RACK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNB2L1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: RACK1
• UniProt ID: P63244
• Protein Sequence: Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI
• NCBI: NP_006089
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Small intestine tissue at an antibody concentration of 5 ug/ml using anti-GNB2L1 antibody (orb577699).

WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Transfected 293T.