RACK1 Rabbit Polyclonal Antibody

• Catalog Number: orb577700
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RACK1
• Target: RACK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1
• Protein Sequence: Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
• UniProt ID: P63244
• MW: 35kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1
• Research Area: Immunology & Inflammation, Molecular Biology
• Note: For research use only
• NCBI: NP_006089
• Expiration Date: 12 months from date of receipt.

Sample Type: MCF-7 WT a whole cell lysates (110 UG), Primary Dilution: 1.5 mg/mL, Secondary Antibody: LI-COR Donkey anti-rabbit, Secondary Dilution: 1:10000. GNB2L1 is supported by BioGPS gene expression data to be expressed in MCF7.

Rabbit Anti-GNB2L1 Antibody, Catalog Number: orb577700, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. GNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-GNB2L1 antibody Titration: 1 ug/ml, Sample Type: Human liver.